PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009614701.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 328aa    MW: 38095.4 Da    PI: 6.086
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009614701.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1721.8e-5371351128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eelv +yLk+k+++ k++l +vi+++d+y++ePwd++      ++e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+v
  XP_009614701.1   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVITDIDLYRIEPWDIEGrckLGYEEQNEWYFFSHKDRKYPTGTRTNRATTAGFWKATGRDKAV 100
                     69****************************.9***************952432234677************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ls k++ +g++ktLvfykgrap+g+k+dW+mheyrl
  XP_009614701.1 101 LS-KEKIIGMRKTLVFYKGRAPNGRKSDWIMHEYRL 135
                     **.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-595156IPR003441NAC domain
PROSITE profilePS5100558.5047156IPR003441NAC domain
PfamPF023652.0E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEMDSCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIT DIDLYRIEPW DIEGRCKLGY  60
EEQNEWYFFS HKDRKYPTGT RTNRATTAGF WKATGRDKAV LSKEKIIGMR KTLVFYKGRA  120
PNGRKSDWIM HEYRLQSSEH APPQEEGWVV CRAFKKPTPN KQPCLDLAWQ NAYYIRGANT  180
TYRPSSSLSE IPSPMHQPLN NAFNQTTNFH QFTFNPSHDH QNMIINSSQN YFENQLAELP  240
QLDSPTISTS LCTIDKSLGE QNYTANNEDD CEEVKHSNGI NNSQFYDDWK NFDTLIEPLS  300
HSFTNPPLLN RDDSQNHISH LLDCLPDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-47215610168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869361e-170JQ686936.1 Nicotiana tabacum cultivar SR1 NAC domain-containing protein 7 (VND7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009614700.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_009614701.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_016458224.10.0PREDICTED: NAC domain-containing protein 30-like
RefseqXP_016458225.10.0PREDICTED: NAC domain-containing protein 30-like
SwissprotQ9C8W91e-114NAC30_ARATH; NAC domain-containing protein 30
TrEMBLM1CGN50.0M1CGN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000670860.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-103vascular related NAC-domain protein 7